Lineage for d1wyqa1 (1wyq A:8-121)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712024Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2712088Protein automated matches [191021] (2 species)
    not a true protein
  7. 2712089Species Human (Homo sapiens) [TaxId:9606] [188812] (7 PDB entries)
  8. 2712096Domain d1wyqa1: 1wyq A:8-121 [240934]
    Other proteins in same PDB: d1wyqa2, d1wyqa3
    automated match to d1bkra_

Details for d1wyqa1

PDB Entry: 1wyq (more details)

PDB Description: solution structure of the second ch domain of human spectrin beta chain, brain 2
PDB Compounds: (A:) Spectrin beta chain, brain 2

SCOPe Domain Sequences for d1wyqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyqa1 a.40.1.1 (A:8-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akdalllwcqmktagypnvnvhnfttswrdglafnaivhkhrpdlldfeslkkcnahynl
qnafnlaekelgltklldpedvnvdqpdeksiityvatyyhyfskmkalavegk

SCOPe Domain Coordinates for d1wyqa1:

Click to download the PDB-style file with coordinates for d1wyqa1.
(The format of our PDB-style files is described here.)

Timeline for d1wyqa1: