SCOPe 2.07: Domain d1wyqa1: 1wyq A:8-121

Lineage for d1wyqa1 (1wyq A:8-121)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 protein domains)
   Pfam PF00307

6. Protein automated matches [191021] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188812] (7 PDB entries)

8. Domain d1wyqa1: 1wyq A:8-121 [240934]
   Other proteins in same PDB: d1wyqa2, d1wyqa3
   automated match to d1bkra_

Details for d1wyqa1

PDB Entry: 1wyq

PDB Description: Solution structure of the second CH domain of human spectrin beta chain, brain 2

PDB Compounds: (A:) Spectrin beta chain, brain 2

SCOPe Domain Sequences for d1wyqa1:

Sequence; same for both SEQRES and ATOM records:

>d1wyqa1 a.40.1.1 (A:8-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akdalllwcqmktagypnvnvhnfttswrdglafnaivhkhrpdlldfeslkkcnahynl
qnafnlaekelgltklldpedvnvdqpdeksiityvatyyhyfskmkalavegk

Timeline for d1wyqa1:

• d1wyqa1 first appeared in SCOPe 2.04, called d1wyqa_
  
• d1wyqa1 appears in SCOPe 2.06