![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
![]() | Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
![]() | Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins) Pfam PF00307 |
![]() | Protein automated matches [191021] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188812] (7 PDB entries) |
![]() | Domain d1wyqa1: 1wyq A:8-121 [240934] Other proteins in same PDB: d1wyqa2, d1wyqa3 automated match to d1bkra_ |
PDB Entry: 1wyq (more details)
SCOPe Domain Sequences for d1wyqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wyqa1 a.40.1.1 (A:8-121) automated matches {Human (Homo sapiens) [TaxId: 9606]} akdalllwcqmktagypnvnvhnfttswrdglafnaivhkhrpdlldfeslkkcnahynl qnafnlaekelgltklldpedvnvdqpdeksiityvatyyhyfskmkalavegk
Timeline for d1wyqa1: