SCOPe 2.08: Domain d1wypa1: 1wyp A:8-130

Lineage for d1wypa1 (1wyp A:8-130)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)

8. Domain d1wypa1: 1wyp A:8-130 [240933]
   Other proteins in same PDB: d1wypa2, d1wypa3
   automated match to d1ujoa_

Details for d1wypa1

PDB Entry: 1wyp

PDB Description: solution structure of the ch domain of human calponin 1

PDB Compounds: (A:) Calponin 1

SCOPe Domain Sequences for d1wypa1:

Sequence; same for both SEQRES and ATOM records:

>d1wypa1 a.40.1.0 (A:8-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nklaqkydhqreqelrewiegvtgrrignnfmdglkdgiilcefinklqpgsvkkinest
qnwhqlenignfikaitkygvkphdifeandlfentnhtqvqstllalasmaktkgnkvn
vgv

Timeline for d1wypa1:

• d1wypa1 first appeared in SCOPe 2.04, called d1wypa_
  
• d1wypa1 appears in SCOPe 2.07