SCOPe 2.07: Domain d1wyma1: 1wym A:8-149

Lineage for d1wyma1 (1wym A:8-149)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 protein domains)
   Pfam PF00307

6. Protein automated matches [191021] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188812] (7 PDB entries)

8. Domain d1wyma1: 1wym A:8-149 [240932]
   Other proteins in same PDB: d1wyma2, d1wyma3
   automated match to d1ujoa_

Details for d1wyma1

PDB Entry: 1wym

PDB Description: Solution structure of the CH domain of human transgelin-2

PDB Compounds: (A:) Transgelin-2

SCOPe Domain Sequences for d1wyma1:

Sequence; same for both SEQRES and ATOM records:

>d1wyma1 a.40.1.1 (A:8-149) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkiekqydadleqiliqwittqcrkdvgrpqpgrenfqnwlkdgtvlcelinalypegqa
pvkkiqastmafkqmeqisqflqaaeryginttdifqtvdlwegknmacvqrtlmnlggl
avarddglfsgdpnwfpkkske

Timeline for d1wyma1:

• d1wyma1 first appeared in SCOPe 2.04, called d1wyma_
  
• d1wyma1 appears in SCOPe 2.06