Lineage for d1wxua1 (1wxu A:8-87)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377486Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2377487Protein automated matches [190457] (10 species)
    not a true protein
  7. 2377691Species Mouse (Mus musculus) [TaxId:10090] [189303] (24 PDB entries)
  8. 2377711Domain d1wxua1: 1wxu A:8-87 [240930]
    Other proteins in same PDB: d1wxua2, d1wxua3
    automated match to d1ugva_

Details for d1wxua1

PDB Entry: 1wxu (more details)

PDB Description: Solution structure of the SH3 domain of mouse peroxisomal biogenesis factor 13
PDB Compounds: (A:) peroxisomal biogenesis factor 13

SCOPe Domain Sequences for d1wxua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxua1 b.34.2.0 (A:8-87) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tnwasgeddhvvaraeydfvavsdeeisfragdmlnlalkeqqpkvrgwllasldgqttg
lipanyvkilgkrrgrktie

SCOPe Domain Coordinates for d1wxua1:

Click to download the PDB-style file with coordinates for d1wxua1.
(The format of our PDB-style files is described here.)

Timeline for d1wxua1: