SCOPe 2.08: Domain d1wxua1: 1wxu A:8-87

Lineage for d1wxua1 (1wxu A:8-87)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries)

8. Domain d1wxua1: 1wxu A:8-87 [240930]
   Other proteins in same PDB: d1wxua2, d1wxua3
   automated match to d1ugva_

Details for d1wxua1

PDB Entry: 1wxu

PDB Description: solution structure of the sh3 domain of mouse peroxisomal biogenesis factor 13

PDB Compounds: (A:) peroxisomal biogenesis factor 13

SCOPe Domain Sequences for d1wxua1:

Sequence; same for both SEQRES and ATOM records:

>d1wxua1 b.34.2.0 (A:8-87) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tnwasgeddhvvaraeydfvavsdeeisfragdmlnlalkeqqpkvrgwllasldgqttg
lipanyvkilgkrrgrktie

Timeline for d1wxua1:

• d1wxua1 first appeared in SCOPe 2.04, called d1wxua_
  
• d1wxua1 appears in SCOPe 2.07