SCOP 1.63: Domain d1ciwd_: 1ciw D:

Lineage for d1ciwd_ (1ciw D:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (22 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (7 PDB entries)

8. Domain d1ciwd_: 1ciw D: [24093]
   complexed with ca, gal, mn, nag

Details for d1ciwd_

PDB Entry: 1ciw, 2.7 Å

PDB Description: peanut lectin complexed with n-acetyllactosamine

SCOP Domain Sequences for d1ciwd_:

Sequence; same for both SEQRES and ATOM records:

>d1ciwd_ b.29.1.1 (D:) Legume lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d1ciwd_:

• d1ciwd_ first appeared (with stable ids) in SCOP 1.55
  
• d1ciwd_ appears in SCOP 1.61
  
• d1ciwd_ appears in SCOP 1.65
  
• d1ciwd_ appears in the current release, SCOPe 2.08