SCOPe 2.04: Domain d1wxla_: 1wxl A:

Lineage for d1wxla_ (1wxl A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein automated matches [190434] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189474] (2 PDB entries)

8. Domain d1wxla_: 1wxl A: [240928]
   automated match to d1qrva_

Details for d1wxla_

PDB Entry: 1wxl

PDB Description: solution structure of the hmg-box domain in the ssrp1 subunit of fact

PDB Compounds: (A:) Single-strand recognition protein

SCOPe Domain Sequences for d1wxla_:

Sequence; same for both SEQRES and ATOM records:

>d1wxla_ a.21.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
shmpkrattafmlwlndtresikrenpgikvteiakkggemwkelkdkskwedaaakdkq
ryhdemrnykpea

Timeline for d1wxla_:

• d1wxla_ is new in SCOPe 2.04-stable
  
• d1wxla_ appears in SCOPe 2.05
  
• d1wxla_ appears in the current release, SCOPe 2.08, called d1wxla1