| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
| Family a.21.1.1: HMG-box [47096] (10 proteins) |
| Protein automated matches [190434] (3 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189474] (2 PDB entries) |
| Domain d1wxla1: 1wxl A:5-74 [240928] Other proteins in same PDB: d1wxla2 automated match to d1qrva_ |
PDB Entry: 1wxl (more details)
SCOPe Domain Sequences for d1wxla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wxla1 a.21.1.1 (A:5-74) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pkrattafmlwlndtresikrenpgikvteiakkggemwkelkdkskwedaaakdkqryh
demrnykpea
Timeline for d1wxla1: