SCOPe 2.07: Domain d1wxla1: 1wxl A:5-74

Lineage for d1wxla1 (1wxl A:5-74)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 protein domains)

6. Protein automated matches [190434] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189474] (2 PDB entries)

8. Domain d1wxla1: 1wxl A:5-74 [240928]
   Other proteins in same PDB: d1wxla2
   automated match to d1qrva_

Details for d1wxla1

PDB Entry: 1wxl

PDB Description: Solution Structure of the HMG-box domain in the SSRP1 subunit of FACT

PDB Compounds: (A:) Single-strand recognition protein

SCOPe Domain Sequences for d1wxla1:

Sequence; same for both SEQRES and ATOM records:

>d1wxla1 a.21.1.1 (A:5-74) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pkrattafmlwlndtresikrenpgikvteiakkggemwkelkdkskwedaaakdkqryh
demrnykpea

Timeline for d1wxla1:

• d1wxla1 first appeared in SCOPe 2.04, called d1wxla_
  
• d1wxla1 appears in SCOPe 2.06