Lineage for d1wxla1 (1wxl A:5-74)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2697958Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2698017Protein automated matches [190434] (3 species)
    not a true protein
  7. 2698018Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189474] (2 PDB entries)
  8. 2698025Domain d1wxla1: 1wxl A:5-74 [240928]
    Other proteins in same PDB: d1wxla2
    automated match to d1qrva_

Details for d1wxla1

PDB Entry: 1wxl (more details)

PDB Description: solution structure of the hmg-box domain in the ssrp1 subunit of fact
PDB Compounds: (A:) Single-strand recognition protein

SCOPe Domain Sequences for d1wxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxla1 a.21.1.1 (A:5-74) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pkrattafmlwlndtresikrenpgikvteiakkggemwkelkdkskwedaaakdkqryh
demrnykpea

SCOPe Domain Coordinates for d1wxla1:

Click to download the PDB-style file with coordinates for d1wxla1.
(The format of our PDB-style files is described here.)

Timeline for d1wxla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wxla2