SCOPe 2.08: Domain d1wxcb_: 1wxc B:

Lineage for d1wxcb_ (1wxc B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
   2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386

4. Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families)
   Pfam PF06236

5. Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins)

6. Protein Tyrosinase cofactor MelC1 [254410] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (33 PDB entries)

8. Domain d1wxcb_: 1wxc B: [240927]
   Other proteins in same PDB: d1wxca1, d1wxca2
   automated match to d2ahkb_
   complexed with no3

Details for d1wxcb_

PDB Entry: 1wxc, 1.2 Å

PDB Description: Crystal Structure of the copper-free Streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein

PDB Compounds: (B:) MelC

SCOPe Domain Sequences for d1wxcb_:

Sequence, based on SEQRES records:

>d1wxcb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpargaahhhehgggyevfvdgvqlhvmrnadgswisvvshyd
pvptpraaaraavdelqgapllp

Sequence, based on observed residues (ATOM records):

>d1wxcb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpagyevfvdgvqlhvmrnadgswisvvshydpvptpraaara
avdelqgapllp

Timeline for d1wxcb_:

• d1wxcb_ first appeared in SCOPe 2.04
  
• d1wxcb_ appears in SCOPe 2.07