Class a: All alpha proteins [46456] (289 folds) |
Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily) multihelical |
Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) duplication: contains two structural repeats |
Family a.86.1.3: Tyrosinase [254185] (1 protein) Pfam PF00264 |
Protein Tyrosinase [254409] (1 species) |
Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (23 PDB entries) |
Domain d1wx5c1: 1wx5 C:2-273 [240923] Other proteins in same PDB: d1wx5a2, d1wx5b_, d1wx5c2, d1wx5d_ automated match to d2ahka_ complexed with cl, na |
PDB Entry: 1wx5 (more details), 2.02 Å
SCOPe Domain Sequences for d1wx5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wx5c1 a.86.1.3 (C:2-273) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]} tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt pdvvdlnetmkpwntvrpadlldhtayytfda
Timeline for d1wx5c1:
View in 3D Domains from other chains: (mouse over for more information) d1wx5a1, d1wx5a2, d1wx5b_, d1wx5d_ |