SCOPe 2.05: Domain d1wx4a_: 1wx4 A:

Lineage for d1wx4a_ (1wx4 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.3: Tyrosinase [254185] (1 protein)
   Pfam PF00264

6. Protein Tyrosinase [254409] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (22 PDB entries)

8. Domain d1wx4a_: 1wx4 A: [240919]
   Other proteins in same PDB: d1wx4b_
   automated match to d2ahka_
   complexed with cu, no3, per

Details for d1wx4a_

PDB Entry: 1wx4, 1.5 Å

PDB Description: Crystal structure of the oxy-form of the copper-bound Streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein prepared by the addition of dithiothreitol

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d1wx4a_:

Sequence; same for both SEQRES and ATOM records:

>d1wx4a_ a.86.1.3 (A:) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfdal

Timeline for d1wx4a_:

• d1wx4a_ first appeared in SCOPe 2.04
  
• d1wx4a_ is called d1wx4a1 in SCOPe 2.06
  
• d1wx4a_ appears in the current release, SCOPe 2.08, called d1wx4a1