Lineage for d1wvva_ (1wvv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926515Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2926516Protein automated matches [190563] (18 species)
    not a true protein
  7. 2926583Species Streptomyces griseus [TaxId:1911] [254952] (3 PDB entries)
  8. 2926584Domain d1wvva_: 1wvv A: [240915]
    automated match to d2cjla_
    complexed with cl, gol; mutant

Details for d1wvva_

PDB Entry: 1wvv (more details), 2 Å

PDB Description: crystal structure of chitinase c mutant e147q
PDB Compounds: (A:) chitinase C

SCOPe Domain Sequences for d1wvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvva_ d.2.1.0 (A:) automated matches {Streptomyces griseus [TaxId: 1911]}
ggnngfvvseaqfnqmfpnrnafytykgltdalsaypafaktgsdevkkreaaaflanvs
hqtgglfyikevneanyphycdttqsygcpagqaayygrgpiqlswnfnykaagdalgin
llanpylveqdpavawktglwywnsqngpgtmtphnaivnnagfgetirsingalecngg
npaqvqsrinkftqftqilgtttgpnlsc

SCOPe Domain Coordinates for d1wvva_:

Click to download the PDB-style file with coordinates for d1wvva_.
(The format of our PDB-style files is described here.)

Timeline for d1wvva_: