Lineage for d1wvua_ (1wvu A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2497081Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2497082Protein automated matches [190563] (13 species)
    not a true protein
  7. 2497133Species Streptomyces griseus [TaxId:1911] [254952] (3 PDB entries)
  8. 2497135Domain d1wvua_: 1wvu A: [240914]
    automated match to d2cjla_
    complexed with cl

Details for d1wvua_

PDB Entry: 1wvu (more details), 2.45 Å

PDB Description: Crystal structure of chitinase C from Streptomyces griseus HUT6037
PDB Compounds: (A:) chitinase C

SCOPe Domain Sequences for d1wvua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvua_ d.2.1.0 (A:) automated matches {Streptomyces griseus [TaxId: 1911]}
ggnngfvvseaqfnqmfpnrnafytykgltdalsaypafaktgsdevkkreaaaflanvs
hetgglfyikevneanyphycdttqsygcpagqaayygrgpiqlswnfnykaagdalgin
llanpylveqdpavawktglwywnsqngpgtmtphnaivnnagfgetirsingalecngg
npaqvqsrinkftqftqilgtttgpnlsc

SCOPe Domain Coordinates for d1wvua_:

Click to download the PDB-style file with coordinates for d1wvua_.
(The format of our PDB-style files is described here.)

Timeline for d1wvua_: