![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
![]() | Protein Zn metallo-beta-lactamase [56283] (14 species) |
![]() | Species Serratia marcescens [TaxId:615] [190018] (8 PDB entries) |
![]() | Domain d1wupc_: 1wup C: [240912] automated match to d4f6ha_ complexed with acy, zn; mutant |
PDB Entry: 1wup (more details), 3 Å
SCOPe Domain Sequences for d1wupc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wupc_ d.157.1.1 (C:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]} slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw fvergykikgsisshfhsestggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl lkskygkaklvvpshsevgdasllkltleqavkglne
Timeline for d1wupc_: