| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
| Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
| Protein Zn metallo-beta-lactamase [56283] (12 species) |
| Species Serratia marcescens [TaxId:615] [190018] (8 PDB entries) |
| Domain d1wupb_: 1wup B: [240911] automated match to d4f6ha_ complexed with acy, zn; mutant |
PDB Entry: 1wup (more details), 3 Å
SCOPe Domain Sequences for d1wupb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wupb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsestggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglne
Timeline for d1wupb_: