Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (10 species) not a true protein |
Species Rhodospirillum rubrum [TaxId:1085] [254949] (1 PDB entry) |
Domain d1wrga_: 1wrg A: [240908] automated match to d1jo5a_ |
PDB Entry: 1wrg (more details)
SCOPe Domain Sequences for d1wrga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wrga_ f.3.1.0 (A:) automated matches {Rhodospirillum rubrum [TaxId: 1085]} aevkqeslsgitegeakefhkiftssilvffgvaafahllvwiwrpwvpgpngys
Timeline for d1wrga_: