Lineage for d1wr7a1 (1wr7 A:6-41)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401160Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2401161Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2401282Family b.72.1.0: automated matches [227264] (1 protein)
    not a true family
  6. 2401283Protein automated matches [227055] (4 species)
    not a true protein
  7. 2401300Species Mouse (Mus musculus) [TaxId:10090] [254948] (4 PDB entries)
  8. 2401303Domain d1wr7a1: 1wr7 A:6-41 [240907]
    Other proteins in same PDB: d1wr7a2
    automated match to d4n7fa_

Details for d1wr7a1

PDB Entry: 1wr7 (more details)

PDB Description: Solution structure of the third WW domain of Nedd4-2
PDB Compounds: (A:) Nedd4-2

SCOPe Domain Sequences for d1wr7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wr7a1 b.72.1.0 (A:6-41) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsflppgwemriapngrpffidhntktttwedprlk

SCOPe Domain Coordinates for d1wr7a1:

Click to download the PDB-style file with coordinates for d1wr7a1.
(The format of our PDB-style files is described here.)

Timeline for d1wr7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wr7a2