Lineage for d1wpra1 (1wpr A:5-269)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136139Species Bacillus subtilis [TaxId:1423] [225226] (4 PDB entries)
  8. 2136142Domain d1wpra1: 1wpr A:5-269 [240904]
    Other proteins in same PDB: d1wpra2, d1wprb2
    automated match to d1woma_
    complexed with gol, pms

Details for d1wpra1

PDB Entry: 1wpr (more details), 2.6 Å

PDB Description: Crystal structure of RsbQ inhibited by PMSF
PDB Compounds: (A:) Sigma factor sigB regulation protein rsbQ

SCOPe Domain Sequences for d1wpra1:

Sequence, based on SEQRES records: (download)

>d1wpra1 c.69.1.0 (A:5-269) automated matches {Bacillus subtilis [TaxId: 1423]}
ilsrnhvkvkgsgkasimfapgfgcdqsvwnavapafeedhrvilfdyvgsghsdlrayd
lnryqtldgyaqdvldvcealdlketvfvghsvgaligmlasirrpelfshlvmvgpspc
ylndppeyyggfeeeqllgllemmeknyigwatvfaatvlnqpdrpeikeelesrfcstd
pviarqfakaaffsdhredlskvtvpslilqcaddiiapatvgkymhqhlpysslkqmea
rghcphmshpdetiqligdylkahv

Sequence, based on observed residues (ATOM records): (download)

>d1wpra1 c.69.1.0 (A:5-269) automated matches {Bacillus subtilis [TaxId: 1423]}
ilsrnhvkvkgsgkasimfapgfgcdqsvwnavapafeedhrvilfdyvgsghsdlydln
ryqtldgyaqdvldvcealdlketvfvghsvgaligmlasirrpelfshlvmvgpspcyl
ndppeyyggfeeeqllgllemmeknyigwatvfaatvlnqpdrpeikeelesrfcstdpv
iarqfakaaffsdhredlskvtvpslilqcaddiiapatvgkymhqhlpysslkqmearg
hcphmshpdetiqligdylkahv

SCOPe Domain Coordinates for d1wpra1:

Click to download the PDB-style file with coordinates for d1wpra1.
(The format of our PDB-style files is described here.)

Timeline for d1wpra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wpra2