SCOPe 2.05: Domain d1wcrb_: 1wcr B:

Lineage for d1wcrb_ (1wcr B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families)

5. Family a.7.2.0: automated matches [191602] (1 protein)
   not a true family

6. Protein automated matches [191097] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254944] (1 PDB entry)

8. Domain d1wcrb_: 1wcr B: [240900]
   automated match to d3l8ra_

Details for d1wcrb_

PDB Entry: 1wcr

PDB Description: trimeric structure of the enzyme iia from escherichia coli phosphotransferase system specific for n,n'-diacetylchitobiose

PDB Compounds: (B:) pts system, n, n'-diacetylchitobiose-specific iia component

SCOPe Domain Sequences for d1wcrb_:

Sequence; same for both SEQRES and ATOM records:

>d1wcrb_ a.7.2.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlvhaqlhlmtsmlarelitelielheklka

Timeline for d1wcrb_:

• d1wcrb_ first appeared in SCOPe 2.04
  
• d1wcrb_ appears in SCOPe 2.06
  
• d1wcrb_ appears in the current release, SCOPe 2.08