Lineage for d1wcrb_ (1wcr B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696555Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) (S)
  5. 2696565Family a.7.2.0: automated matches [191602] (1 protein)
    not a true family
  6. 2696566Protein automated matches [191097] (4 species)
    not a true protein
  7. 2696584Species Escherichia coli [TaxId:562] [254944] (1 PDB entry)
  8. 2696586Domain d1wcrb_: 1wcr B: [240900]
    automated match to d3l8ra_

Details for d1wcrb_

PDB Entry: 1wcr (more details)

PDB Description: trimeric structure of the enzyme iia from escherichia coli phosphotransferase system specific for n,n'-diacetylchitobiose
PDB Compounds: (B:) pts system, n, n'-diacetylchitobiose-specific iia component

SCOPe Domain Sequences for d1wcrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcrb_ a.7.2.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlvhaqlhlmtsmlarelitelielheklka

SCOPe Domain Coordinates for d1wcrb_:

Click to download the PDB-style file with coordinates for d1wcrb_.
(The format of our PDB-style files is described here.)

Timeline for d1wcrb_: