SCOP 1.67: Domain d2tepd_: 2tep D:

Lineage for d2tepd_ (2tep D:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (14 PDB entries)

8. Domain d2tepd_: 2tep D: [24089]
   complexed with ca, gal, mn, nga

Details for d2tepd_

PDB Entry: 2tep, 2.5 Å

PDB Description: peanut lectin complexed with t-antigenic disaccharide

SCOP Domain Sequences for d2tepd_:

Sequence; same for both SEQRES and ATOM records:

>d2tepd_ b.29.1.1 (D:) Legume lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d2tepd_:

• d2tepd_ first appeared (with stable ids) in SCOP 1.55
  
• d2tepd_ appears in SCOP 1.65
  
• d2tepd_ appears in SCOP 1.69
  
• d2tepd_ appears in the current release, SCOPe 2.08