| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.1: Legume lectins [49900] (5 proteins) |
| Protein Legume lectin [49904] (23 species) |
| Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (30 PDB entries) Uniprot P02872 24-255 |
| Domain d2tepd_: 2tep D: [24089] complexed with ca, mn |
PDB Entry: 2tep (more details), 2.5 Å
SCOPe Domain Sequences for d2tepd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tepd_ b.29.1.1 (D:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
Timeline for d2tepd_: