Class b: All beta proteins [48724] (176 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
Protein D1 core SNRNP protein [50184] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50185] (5 PDB entries) |
Domain d1vu3y_: 1vu3 Y: [240887] Other proteins in same PDB: d1vu3b_, d1vu3d_, d1vu3f_, d1vu3h_, d1vu3j_, d1vu3l_, d1vu3n_, d1vu3p_, d1vu3r_, d1vu3t_, d1vu3v_, d1vu3x_, d1vu3z_ automated match to d4f7ua_ complexed with so4 |
PDB Entry: 1vu3 (more details), 3.1 Å
SCOPe Domain Sequences for d1vu3y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vu3y_ b.38.1.1 (Y:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir gnniryfilpdslpldtllvdv
Timeline for d1vu3y_: