Lineage for d2tepa_ (2tep A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12607Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (5 PDB entries)
  8. 12612Domain d2tepa_: 2tep A: [24086]

Details for d2tepa_

PDB Entry: 2tep (more details), 2.5 Å

PDB Description: peanut lectin complexed with t-antigenic disaccharide

SCOP Domain Sequences for d2tepa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tepa_ b.29.1.1 (A:) Lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d2tepa_:

Click to download the PDB-style file with coordinates for d2tepa_.
(The format of our PDB-style files is described here.)

Timeline for d2tepa_: