SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1vu1z_ (1vu1 z:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076263Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2076282Family b.121.5.2: Parvoviridae-like VP [88646] (3 protein domains)
    automatically mapped to Pfam PF00740
  6. 2076308Protein automated matches [190920] (6 species)
    not a true protein
  7. 2076320Species Adeno-associated virus - 6 [TaxId:68558] [254925] (5 PDB entries)
  8. 2076361Domain d1vu1z_: 1vu1 z: [240848]

Details for d1vu1z_

PDB Entry: 1vu1 (more details), 3 Å

PDB Description: Structure-function Analysis of Receptor-binding in Adeno-Associated Virus Serotype 6 (AAV-6)
PDB Compounds: (z:) Capsid protein VP1

SCOPe Domain Sequences for d1vu1z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vu1z_ b.121.5.2 (z:) automated matches {Adeno-associated virus - 6 [TaxId: 68558]}
gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
pevqytsnyaksanvdftvdnnglyteprpigtryltrpl

SCOPe Domain Coordinates for d1vu1z_:

Click to download the PDB-style file with coordinates for d1vu1z_.
(The format of our PDB-style files is described here.)

Timeline for d1vu1z_: