Lineage for d1vu1z_ (1vu1 z:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076263Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2076282Family b.121.5.2: Parvoviridae-like VP [88646] (3 protein domains)
    automatically mapped to Pfam PF00740
  6. 2076308Protein automated matches [190920] (6 species)
    not a true protein
  7. 2076320Species Adeno-associated virus - 6 [TaxId:68558] [254925] (5 PDB entries)
  8. 2076361Domain d1vu1z_: 1vu1 z: [240848]

Details for d1vu1z_

PDB Entry: 1vu1 (more details), 3 Å

PDB Description: Structure-function Analysis of Receptor-binding in Adeno-Associated Virus Serotype 6 (AAV-6)
PDB Compounds: (z:) Capsid protein VP1

SCOPe Domain Sequences for d1vu1z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vu1z_ b.121.5.2 (z:) automated matches {Adeno-associated virus - 6 [TaxId: 68558]}
gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
eyfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
iinpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
fgtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
gfglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
pevqytsnyaksanvdftvdnnglyteprpigtryltrpl

SCOPe Domain Coordinates for d1vu1z_:

Click to download the PDB-style file with coordinates for d1vu1z_.
(The format of our PDB-style files is described here.)

Timeline for d1vu1z_: