SCOPe 2.03: Domain d1lgb.1: 1lgb A:,B:

Lineage for d1lgb.1 (1lgb A:,B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Lathyrus ochrus, isolectin II [TaxId:3858] [49911] (2 PDB entries)

8. Domain d1lgb.1: 1lgb A:,B: [24081]
   Other proteins in same PDB: d1lgbc_
   complexed with ca, mn

Details for d1lgb.1

PDB Entry: 1lgb, 3.3 Å

PDB Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety

PDB Compounds: (A:) legume isolectin II (alpha chain), (B:) legume isolectin II (beta chain)

SCOPe Domain Sequences for d1lgb.1:

Sequence; same for both SEQRES and ATOM records:

>g1lgb.1 b.29.1.1 (A:,B:) Legume lectin {Lathyrus ochrus, isolectin II [TaxId: 3858]}
tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafngatnvltvsltyp
nXtsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselav

Timeline for d1lgb.1:

• d1lgb.1 first appeared (with stable ids) in SCOP 1.55
  
• d1lgb.1 appears in SCOPe 2.02
  
• d1lgb.1 appears in SCOPe 2.04
  
• d1lgb.1 appears in the current release, SCOPe 2.08