Lineage for d1lgb.1 (1lgb A:,B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 294478Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 294600Protein Legume lectin [49904] (22 species)
  7. 294735Species Lathyrus ochrus, isolectin II [TaxId:3858] [49911] (2 PDB entries)
  8. 294739Domain d1lgb.1: 1lgb A:,B: [24081]
    Other proteins in same PDB: d1lgbc_
    complexed with ca, fuc, gal, man, mn, nag

Details for d1lgb.1

PDB Entry: 1lgb (more details), 3.3 Å

PDB Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety

SCOP Domain Sequences for d1lgb.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lgb.1 b.29.1.1 (A:,B:) Legume lectin {Lathyrus ochrus, isolectin II}
tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafngatnvltvsltyp
nXtsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselav

SCOP Domain Coordinates for d1lgb.1:

Click to download the PDB-style file with coordinates for d1lgb.1.
(The format of our PDB-style files is described here.)

Timeline for d1lgb.1: