Lineage for d1vsyz_ (1vsy Z:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2597201Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2597210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2598860Domain d1vsyz_: 1vsy Z: [240808]
    Other proteins in same PDB: d1vsy1_, d1vsy2_, d1vsya_, d1vsyb_, d1vsyc_, d1vsyd_, d1vsyf_, d1vsyg_, d1vsyh1, d1vsyh2, d1vsyi_, d1vsyj_, d1vsyk_, d1vsym_, d1vsyn_, d1vsyo_, d1vsyp_, d1vsyq_, d1vsyr_, d1vsyt_, d1vsyu_, d1vsyv1, d1vsyv2, d1vsyw_, d1vsyx_, d1vsyy_

Details for d1vsyz_

PDB Entry: 1vsy (more details), 3 Å

PDB Description: Proteasome Activator Complex
PDB Compounds: (Z:) Proteasome component PRE2

SCOPe Domain Sequences for d1vsyz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsyz_ d.153.1.4 (Z:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkrvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d1vsyz_:

Click to download the PDB-style file with coordinates for d1vsyz_.
(The format of our PDB-style files is described here.)

Timeline for d1vsyz_: