Lineage for d1vsyt_ (1vsy T:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1934686Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1934702Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1935214Domain d1vsyt_: 1vsy T: [240802]
    Other proteins in same PDB: d1vsya_, d1vsyc_, d1vsyd_, d1vsyh_, d1vsyl_, d1vsyo_, d1vsyq_, d1vsyr_, d1vsyv_, d1vsyz_

Details for d1vsyt_

PDB Entry: 1vsy (more details), 3 Å

PDB Description: Proteasome Activator Complex
PDB Compounds: (T:) Proteasome component PRE5

SCOPe Domain Sequences for d1vsyt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsyt_ d.153.1.4 (T:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d1vsyt_:

Click to download the PDB-style file with coordinates for d1vsyt_.
(The format of our PDB-style files is described here.)

Timeline for d1vsyt_: