Lineage for d1lgc.2 (1lgc C:,D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388157Protein Legume lectin [49904] (23 species)
  7. 2388313Species Lathyrus ochrus, isolectin II [TaxId:3858] [49911] (2 PDB entries)
  8. 2388315Domain d1lgc.2: 1lgc C:,D: [24079]
    complexed with ca, mn, mpd

Details for d1lgc.2

PDB Entry: 1lgc (more details), 2.8 Å

PDB Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety
PDB Compounds: (C:) legume isolectin II (alpha chain), (D:) legume isolectin II (beta chain)

SCOPe Domain Sequences for d1lgc.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lgc.2 b.29.1.1 (C:,D:) Legume lectin {Lathyrus ochrus, isolectin II [TaxId: 3858]}
tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafngatnvltvsltyp
nXetsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselsv

SCOPe Domain Coordinates for d1lgc.2:

Click to download the PDB-style file with coordinates for d1lgc.2.
(The format of our PDB-style files is described here.)

Timeline for d1lgc.2: