Lineage for d1lgc.2 (1lgc C:,D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12596Species Lathyrus ochrus, isolectin II [TaxId:3858] [49911] (2 PDB entries)
  8. 12598Domain d1lgc.2: 1lgc C:,D: [24079]

Details for d1lgc.2

PDB Entry: 1lgc (more details), 2.8 Å

PDB Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety

SCOP Domain Sequences for d1lgc.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lgc.2 b.29.1.1 (C:,D:) Lectin {Lathyrus ochrus, isolectin II}
tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafngatnvltvsltyp
nXetsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselsv

SCOP Domain Coordinates for d1lgc.2:

Click to download the PDB-style file with coordinates for d1lgc.2.
(The format of our PDB-style files is described here.)

Timeline for d1lgc.2: