![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226776] (4 PDB entries) |
![]() | Domain d1v1ga_: 1v1g A: [240783] automated match to d1uhna_ complexed with ca, iod, mpd |
PDB Entry: 1v1g (more details), 2.7 Å
SCOPe Domain Sequences for d1v1ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1ga_ a.39.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rppgyedpellasvtpftveevealyelfkklsssiiddglihkeefqlalfrnrnrrnl fadrifdvfdvkrngviefgefvrslgvfhpsapvhekvkfafklydlrqtgfiereelk emvvallheselvlsedmievmvdkafvqadrkndgkididewkdfvslnpsliknmtlp ylkdinrt
Timeline for d1v1ga_: