SCOP 1.65: Domain d1lgc.1: 1lgc A:,B:

Lineage for d1lgc.1 (1lgc A:,B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (22 species)

7. Species Lathyrus ochrus, isolectin II [TaxId:3858] [49911] (2 PDB entries)

8. Domain d1lgc.1: 1lgc A:,B: [24078]

Details for d1lgc.1

PDB Entry: 1lgc, 2.8 Å

PDB Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety

SCOP Domain Sequences for d1lgc.1:

Sequence; same for both SEQRES and ATOM records:

>g1lgc.1 b.29.1.1 (A:,B:) Legume lectin {Lathyrus ochrus, isolectin II}
tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafngatnvltvsltyp
nXetsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselsvtss

Timeline for d1lgc.1:

• d1lgc.1 first appeared (with stable ids) in SCOP 1.55
  
• d1lgc.1 appears in SCOP 1.63
  
• d1lgc.1 appears in SCOP 1.67
  
• d1lgc.1 appears in the current release, SCOPe 2.08