SCOPe 2.07: Domain d1u4fc_: 1u4f C:

Lineage for d1u4fc_ (1u4f C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein automated matches [190782] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188028] (10 PDB entries)

8. Domain d1u4fc_: 1u4f C: [240777]
   automated match to d2gixa_

Details for d1u4fc_

PDB Entry: 1u4f, 2.41 Å

PDB Description: crystal structure of cytoplasmic domains of irk1 (kir2.1) channel

PDB Compounds: (C:) Inward rectifier potassium channel 2

SCOPe Domain Sequences for d1u4fc_:

Sequence, based on SEQRES records:

>d1u4fc_ b.1.18.16 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlrkshlveahvr
aqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlskqdid
nadfeivvilegmveatamttqcrssylaneilwghryepvlfeekhyykvdysrfhkty
evpntplcsardlaekk

Sequence, based on observed residues (ATOM records):

>d1u4fc_ b.1.18.16 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srfvkkdghcnvqfinvgenetlvfshnaviamrdgklclmwrvgnlrkshlveahvraq
llksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlskqdidna
dfeivvilegmveatamttqcrssylaneilwghryepvlfeekhyykvdysrfhktyev
pntplcsardlaekk

Timeline for d1u4fc_:

• d1u4fc_ first appeared in SCOPe 2.04
  
• d1u4fc_ appears in SCOPe 2.06
  
• d1u4fc_ appears in the current release, SCOPe 2.08