Lineage for d1u4fb_ (1u4f B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)
  6. Protein automated matches [190782] (2 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [188028] (10 PDB entries)
  8. Domain d1u4fb_: 1u4f B: [240776]
    automated match to d2gixa_

Details for d1u4fb_

PDB Entry: 1u4f (more details), 2.4099999999999997 Å

PDB Description: crystal structure of cytoplasmic domains of irk1 (kir2.1) channel
PDB Compounds: (B:) Inward rectifier potassium channel 2

SCOPe Domain Sequences for d1u4fb_:

Sequence, based on SEQRES records: (download)

>d1u4fb_ b.1.18.16 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlrkshlveahvr
aqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlskqdid
nadfeivvilegmveatamttqcrssylaneilwghryepvlfeekhyykvdysrfhkty
evpntplcsardlaekk

Sequence, based on observed residues (ATOM records): (download)

>d1u4fb_ b.1.18.16 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srfvkkdghcnvqfinvgenetlvfshnaviamrdgklclmwrvgnlrkshlveahvraq
llksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlskqdidna
dfeivvilegmveatamttqcrssylaneilwghryepvlfeekhyykvdysrfhktyev
pntplcsardlaekk

SCOPe Domain Coordinates for d1u4fb_ are not available.

Timeline for d1u4fb_:

Domains from other chains:
(mouse over for more information)
d1u4fa_, d1u4fc_, d1u4fd_