| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) ![]() |
| Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
| Protein automated matches [227011] (2 species) not a true protein |
| Species Staphylococcus carnosus [TaxId:1281] [254906] (1 PDB entry) |
| Domain d1txea_: 1txe A: [240772] automated match to d1qr5a_ mutant |
PDB Entry: 1txe (more details)
SCOPe Domain Sequences for d1txea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txea_ d.94.1.1 (A:) automated matches {Staphylococcus carnosus [TaxId: 1281]}
meqqsytiidetgaharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
itiyadgsdeadaiqaitdvlskeglte
Timeline for d1txea_: