Lineage for d1txea_ (1txe A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919250Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 1919251Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 1919252Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 1919332Protein automated matches [227011] (2 species)
    not a true protein
  7. 1919336Species Staphylococcus carnosus [TaxId:1281] [254906] (1 PDB entry)
  8. 1919337Domain d1txea_: 1txe A: [240772]
    automated match to d1qr5a_
    mutant

Details for d1txea_

PDB Entry: 1txe (more details)

PDB Description: solution structure of the active-centre mutant ile14ala of the histidine-containing phosphocarrier protein (hpr) from staphylococcus carnosus
PDB Compounds: (A:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1txea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txea_ d.94.1.1 (A:) automated matches {Staphylococcus carnosus [TaxId: 1281]}
meqqsytiidetgaharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
itiyadgsdeadaiqaitdvlskeglte

SCOPe Domain Coordinates for d1txea_:

Click to download the PDB-style file with coordinates for d1txea_.
(The format of our PDB-style files is described here.)

Timeline for d1txea_: