SCOPe 2.04: Domain d1txea_: 1txe A:

Lineage for d1txea_ (1txe A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein automated matches [227011] (2 species)
   not a true protein

7. Species Staphylococcus carnosus [TaxId:1281] [254906] (1 PDB entry)

8. Domain d1txea_: 1txe A: [240772]
   automated match to d1qr5a_
   mutant

Details for d1txea_

PDB Entry: 1txe

PDB Description: solution structure of the active-centre mutant ile14ala of the histidine-containing phosphocarrier protein (hpr) from staphylococcus carnosus

PDB Compounds: (A:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1txea_:

Sequence; same for both SEQRES and ATOM records:

>d1txea_ d.94.1.1 (A:) automated matches {Staphylococcus carnosus [TaxId: 1281]}
meqqsytiidetgaharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
itiyadgsdeadaiqaitdvlskeglte

Timeline for d1txea_:

• d1txea_ is new in SCOPe 2.04-stable
  
• d1txea_ appears in SCOPe 2.05
  
• d1txea_ appears in the current release, SCOPe 2.08