![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.4: Parvalbumin [47492] (3 proteins) 6-helices; array of 3 hairpins, closed made with two-helical hairpin and two EF-hands |
![]() | Protein automated matches [254433] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [254903] (1 PDB entry) |
![]() | Domain d1ttxa_: 1ttx A: [240770] automated match to d1rroa_ complexed with ca |
PDB Entry: 1ttx (more details)
SCOPe Domain Sequences for d1ttxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ttxa_ a.39.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} msitdvlsaddiaaalqecrdpdtfepqkffqtsglskmsanqvkdvfrfidndqsgyld eeelkfflqkfesgareltesetkslmaaadndgdgkigaeefqemvhs
Timeline for d1ttxa_: