Lineage for d1lof.2 (1lof C:,D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371377Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)
  8. 371399Domain d1lof.2: 1lof C:,D: [24077]
    complexed with ca, gal, man, mn, nag

Details for d1lof.2

PDB Entry: 1lof (more details), 2.3 Å

PDB Description: x-ray structure of a biantennary octasaccharide-lectin complex at 2.3 angstroms resolution

SCOP Domain Sequences for d1lof.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lof.2 b.29.1.1 (C:,D:) Legume lectin {Lathyrus ochrus, isolectin I}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafnaatnvltvsltyp
Xetsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtssn

SCOP Domain Coordinates for d1lof.2:

Click to download the PDB-style file with coordinates for d1lof.2.
(The format of our PDB-style files is described here.)

Timeline for d1lof.2: