SCOPe 2.04: Domain d1t12a_: 1t12 A:

Lineage for d1t12a_ (1t12 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)

6. Protein automated matches [190480] (2 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [254901] (1 PDB entry)

8. Domain d1t12a_: 1t12 A: [240767]
   automated match to d1fk5a_

Details for d1t12a_

PDB Entry: 1t12

PDB Description: solution structure of a new ltp1

PDB Compounds: (A:) nonspecific lipid-transfer protein 1

SCOPe Domain Sequences for d1t12a_:

Sequence; same for both SEQRES and ATOM records:

>d1t12a_ a.52.1.1 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
aitcgqvtsnlapclaylrntgplgrccggvkalvnsarttedrqiactclksaagaisg
inlgkaaglpstcgvnipykispstdcskvq

Timeline for d1t12a_:

• d1t12a_ is new in SCOPe 2.04-stable
  
• d1t12a_ appears in SCOPe 2.05
  
• d1t12a_ appears in the current release, SCOPe 2.08