SCOPe 2.06: Domain d1sv2b_: 1sv2 B:

Lineage for d1sv2b_ (1sv2 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Leptospira interrogans [TaxId:173] [103340] (5 PDB entries)
   Uniprot Q72S74

8. Domain d1sv2b_: 1sv2 B: [240766]
   automated match to d1y6ha_
   complexed with dtt, fmt, zn

Details for d1sv2b_

PDB Entry: 1sv2, 3 Å

PDB Description: Crystal Structure of Peptide Deformylase from Leptospira Interrogans (LiPDF) at pH7.5

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d1sv2b_:

Sequence; same for both SEQRES and ATOM records:

>d1sv2b_ d.167.1.1 (B:) Peptide deformylase {Leptospira interrogans [TaxId: 173]}
svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldss

Timeline for d1sv2b_:

• d1sv2b_ first appeared in SCOPe 2.04
  
• d1sv2b_ appears in SCOPe 2.05
  
• d1sv2b_ appears in SCOPe 2.07
  
• d1sv2b_ appears in the current release, SCOPe 2.08