Lineage for d1st7a_ (1st7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697427Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 2697448Family a.11.1.0: automated matches [191596] (1 protein)
    not a true family
  6. 2697449Protein automated matches [191086] (6 species)
    not a true protein
  7. 2697452Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254899] (1 PDB entry)
  8. 2697453Domain d1st7a_: 1st7 A: [240764]
    automated match to d2cb8a_

Details for d1st7a_

PDB Entry: 1st7 (more details)

PDB Description: solution structure of acyl coenzyme a binding protein from yeast
PDB Compounds: (A:) acyl-coa-binding protein

SCOPe Domain Sequences for d1st7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1st7a_ a.11.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vsqlfeekakavnelptkpstdellelyalykqatvgdndkekpgifnmkdrykweawen
lkgksqedaekeyialvdqliakyss

SCOPe Domain Coordinates for d1st7a_:

Click to download the PDB-style file with coordinates for d1st7a_.
(The format of our PDB-style files is described here.)

Timeline for d1st7a_: