SCOPe 2.05: Domain d1sjib2: 1sji B:127-228

Lineage for d1sjib2 (1sji B:127-228)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Canis lupus [TaxId:9615] [254889] (1 PDB entry)

8. Domain d1sjib2: 1sji B:127-228 [240761]
   automated match to d3us3a2

Details for d1sjib2

PDB Entry: 1sji, 2.4 Å

PDB Description: comparing skeletal and cardiac calsequestrin structures and their calcium binding: a proposed mechanism for coupled calcium binding and protein polymerization

PDB Compounds: (B:) Calsequestrin, cardiac muscle isoform

SCOPe Domain Sequences for d1sjib2:

Sequence; same for both SEQRES and ATOM records:

>d1sjib2 c.47.1.0 (B:127-228) automated matches {Canis lupus [TaxId: 9615]}
veiinsklevqaferiedqikligffkseeseyykafeeaaehfqpyikffatfdkgvak
klslkmnevdfyepfmdepiaipdkpyteeelvefvkehqrp

Timeline for d1sjib2:

• d1sjib2 first appeared in SCOPe 2.04
  
• d1sjib2 appears in SCOPe 2.06
  
• d1sjib2 appears in the current release, SCOPe 2.08