Lineage for d1lof.1 (1lof A:,B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1779938Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1780101Protein Legume lectin [49904] (23 species)
  7. 1780230Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)
  8. 1780251Domain d1lof.1: 1lof A:,B: [24076]
    complexed with ca, gal, mn

Details for d1lof.1

PDB Entry: 1lof (more details), 2.3 Å

PDB Description: x-ray structure of a biantennary octasaccharide-lectin complex at 2.3 angstroms resolution
PDB Compounds: (A:) legume isolectin I (alpha chain), (B:) legume isolectin I (beta chain)

SCOPe Domain Sequences for d1lof.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lof.1 b.29.1.1 (A:,B:) Legume lectin {Lathyrus ochrus, isolectin I [TaxId: 3858]}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
nXetsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela

SCOPe Domain Coordinates for d1lof.1:

Click to download the PDB-style file with coordinates for d1lof.1.
(The format of our PDB-style files is described here.)

Timeline for d1lof.1: