Lineage for d1sjia2 (1sji A:127-228)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879345Species Canis lupus [TaxId:9615] [254889] (1 PDB entry)
  8. 2879347Domain d1sjia2: 1sji A:127-228 [240758]
    automated match to d3us3a2

Details for d1sjia2

PDB Entry: 1sji (more details), 2.4 Å

PDB Description: comparing skeletal and cardiac calsequestrin structures and their calcium binding: a proposed mechanism for coupled calcium binding and protein polymerization
PDB Compounds: (A:) Calsequestrin, cardiac muscle isoform

SCOPe Domain Sequences for d1sjia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjia2 c.47.1.0 (A:127-228) automated matches {Canis lupus [TaxId: 9615]}
veiinsklevqaferiedqikligffkseeseyykafeeaaehfqpyikffatfdkgvak
klslkmnevdfyepfmdepiaipdkpyteeelvefvkehqrp

SCOPe Domain Coordinates for d1sjia2:

Click to download the PDB-style file with coordinates for d1sjia2.
(The format of our PDB-style files is described here.)

Timeline for d1sjia2: