Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Canis lupus [TaxId:9615] [254889] (1 PDB entry) |
Domain d1sjia1: 1sji A:3-126 [240757] automated match to d1a8ya1 |
PDB Entry: 1sji (more details), 2.4 Å
SCOPe Domain Sequences for d1sjia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjia1 c.47.1.0 (A:3-126) automated matches {Canis lupus [TaxId: 9615]} glnfptydgkdrvvslteknfkqvlkkydvlclyyhesvssdkvaqkqfqlkeivlelva qvlehkdigfvmvdakkeaklakklgfdeegslyvlkgdrtiefdgefaadvlveflldl iedp
Timeline for d1sjia1: