SCOPe 2.07: Domain d1siya_: 1siy A:

Lineage for d1siya_ (1siy A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.0: automated matches [254196] (1 protein)
   not a true family

6. Protein automated matches [254428] (8 species)
   not a true protein

7. Species Vigna radiata [TaxId:3916] [254887] (1 PDB entry)

8. Domain d1siya_: 1siy A: [240755]
   automated match to d1fk5a_

Details for d1siya_

PDB Entry: 1siy

PDB Description: nmr structure of mung bean non-specific lipid transfer protein 1

PDB Compounds: (A:) nonspecific lipid-transfer protein 1

SCOPe Domain Sequences for d1siya_:

Sequence; same for both SEQRES and ATOM records:

>d1siya_ a.52.1.0 (A:) automated matches {Vigna radiata [TaxId: 3916]}
mtcgqvqgnlaqcigflqkggvvppscctgvknilnssrttadrravcsclkaaagavrg
inpnnaealpgkcgvnipykiststncnsin

Timeline for d1siya_:

• d1siya_ first appeared in SCOPe 2.04
  
• d1siya_ appears in SCOPe 2.06
  
• d1siya_ appears in the current release, SCOPe 2.08