| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
| Family a.52.1.0: automated matches [254196] (1 protein) not a true family |
| Protein automated matches [254428] (8 species) not a true protein |
| Species Vigna radiata [TaxId:3916] [254887] (1 PDB entry) |
| Domain d1siya_: 1siy A: [240755] automated match to d1fk5a_ |
PDB Entry: 1siy (more details)
SCOPe Domain Sequences for d1siya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1siya_ a.52.1.0 (A:) automated matches {Vigna radiata [TaxId: 3916]}
mtcgqvqgnlaqcigflqkggvvppscctgvknilnssrttadrravcsclkaaagavrg
inpnnaealpgkcgvnipykiststncnsin
Timeline for d1siya_: