Lineage for d1siya_ (1siy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714949Family a.52.1.0: automated matches [254196] (1 protein)
    not a true family
  6. 2714950Protein automated matches [254428] (8 species)
    not a true protein
  7. 2714978Species Vigna radiata [TaxId:3916] [254887] (1 PDB entry)
  8. 2714979Domain d1siya_: 1siy A: [240755]
    automated match to d1fk5a_

Details for d1siya_

PDB Entry: 1siy (more details)

PDB Description: nmr structure of mung bean non-specific lipid transfer protein 1
PDB Compounds: (A:) nonspecific lipid-transfer protein 1

SCOPe Domain Sequences for d1siya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1siya_ a.52.1.0 (A:) automated matches {Vigna radiata [TaxId: 3916]}
mtcgqvqgnlaqcigflqkggvvppscctgvknilnssrttadrravcsclkaaagavrg
inpnnaealpgkcgvnipykiststncnsin

SCOPe Domain Coordinates for d1siya_:

Click to download the PDB-style file with coordinates for d1siya_.
(The format of our PDB-style files is described here.)

Timeline for d1siya_: