SCOP 1.65: Domain d1loa.4: 1loa G:,H:

Lineage for d1loa.4 (1loa G:,H:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (22 species)

7. Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)

8. Domain d1loa.4: 1loa G:,H: [24075]
   complexed with ca, mgl, mn

Details for d1loa.4

PDB Entry: 1loa, 2.2 Å

PDB Description: three-dimensional structures of complexes of lathyrus ochrus isolectin i with glucose and mannose: fine specificity of the monosaccharide- binding site

SCOP Domain Sequences for d1loa.4:

Sequence; same for both SEQRES and ATOM records:

>g1loa.4 b.29.1.1 (G:,H:) Legume lectin {Lathyrus ochrus, isolectin I}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xtsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag

Timeline for d1loa.4:

• d1loa.4 first appeared (with stable ids) in SCOP 1.55
  
• d1loa.4 appears in SCOP 1.63
  
• d1loa.4 appears in SCOP 1.67
  
• d1loa.4 appears in the current release, SCOPe 2.08