Lineage for d1loa.4 (1loa G:,H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778616Species Lathyrus ochrus, isolectin I [TaxId:3858] [49910] (7 PDB entries)
  8. 2778638Domain d1loa.4: 1loa G:,H: [24075]
    complexed with ca, gyp, mn

Details for d1loa.4

PDB Entry: 1loa (more details), 2.2 Å

PDB Description: three-dimensional structures of complexes of lathyrus ochrus isolectin i with glucose and mannose: fine specificity of the monosaccharide- binding site
PDB Compounds: (G:) legume isolectin I (alpha chain), (H:) legume isolectin I (beta chain)

SCOPe Domain Sequences for d1loa.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1loa.4 b.29.1.1 (G:,H:) Legume lectin {Lathyrus ochrus, isolectin I [TaxId: 3858]}
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
Xtsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag

SCOPe Domain Coordinates for d1loa.4:

Click to download the PDB-style file with coordinates for d1loa.4.
(The format of our PDB-style files is described here.)

Timeline for d1loa.4: