| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) ![]() contains extra helices in the loops at one end of the bundle |
| Family a.24.11.1: Bacterial GAP domain [47234] (4 proteins) |
| Protein automated matches [254426] (1 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [254884] (1 PDB entry) |
| Domain d1r4ta_: 1r4t A: [240749] automated match to d1he1a_ |
PDB Entry: 1r4t (more details)
SCOPe Domain Sequences for d1r4ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4ta_ a.24.11.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
pmtlkgldkaselatltpeglarehsrlasgdgalrslstalagiragsqveesriqagr
llersiggialqqwgttggaasqlvldaspelrreitdqlhqvmsevallrqavesevsr
vs
Timeline for d1r4ta_: